PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676748250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family SRS
Protein Properties Length: 186aa    MW: 20920.6 Da    PI: 9.1769
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676748250genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702190.37.2e-5931406154
     DUF702   6 asCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskkeletssl 105
                 +C+dCGnqakk+C+++RCRtCCk+++f+C+th+kstWvpa++r+++q q++ +++      ++ ++kr re+  + +s+ ss+ +     + ++ t ++
  676748250   3 RRCEDCGNQAKKECVYMRCRTCCKTKAFHCQTHIKSTWVPAYRRSQKQLQTQPQQK----PLSTINPKRLREQ--HPSSSPSSSGV-----RIHTATGHF 91 
                58*****************************************9998766665433....3355667777776..33334433333.....33455688* PP

     DUF702 106 PeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                P+e++s a frcv+vss+ddg+e++aYqt+v+igGhvf+GiL+dqGle+
  676748250  92 PAELNSLADFRCVKVSSIDDGKEQYAYQTTVNIGGHVFRGILHDQGLEK 140
                **********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051425.4E-562139IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.2E-27546IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.1E-2990138IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MGRRCEDCGN QAKKECVYMR CRTCCKTKAF HCQTHIKSTW VPAYRRSQKQ LQTQPQQKPL  60
STINPKRLRE QHPSSSPSSS GVRIHTATGH FPAELNSLAD FRCVKVSSID DGKEQYAYQT  120
TVNIGGHVFR GILHDQGLEK VVVDHQPASH YNQELLPPSS SSCPLMITSP FTDFMSSSRL  180
TSHQNS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013657988.11e-111PREDICTED: protein SHI RELATED SEQUENCE 3-like
SwissprotQ9SJT83e-92SRS3_ARATH; Protein SHI RELATED SEQUENCE 3
TrEMBLA0A078FRX71e-101A0A078FRX7_BRANA; BnaA04g12150D protein
STRINGBra030301.1-P1e-98(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91882638
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21400.12e-76SHI-related sequence3